Protein Info for Atu2568 in Agrobacterium fabrum C58

Annotation: thiamine biosynthesis oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 64% identical to THIO_RHIEC: Putative thiamine biosynthesis oxidoreductase ThiO (thiO) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K03153, glycine oxidase [EC: 1.4.3.19] (inferred from 100% identity to atu:Atu2568)

Predicted SEED Role

"Glycine oxidase ThiO (EC 1.4.3.19)" in subsystem Thiamin biosynthesis (EC 1.4.3.19)

MetaCyc Pathways

glyphosate degradation II (1/1 steps found)
superpathway of thiamine diphosphate biosynthesis II (7/11 steps found)
thiazole component of thiamine diphosphate biosynthesis II (4/7 steps found)
butanol and isobutanol biosynthesis (engineered) (3/8 steps found)

KEGG Metabolic Maps

Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.19

Use Curated BLAST to search for 1.4.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CWR6 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Atu2568 thiamine biosynthesis oxidoreductase (Agrobacterium fabrum C58)
MRVLVKGTGVAGLTAAFELVRSGVTVEVSECHAKPSRGASFFAGGMLAPWCERESAEEAV
LTLGQAALDWWDEATPDLVVRNGTLVVAPARDKAELLRFASRTSGYRWVDEAEIADLEPD
LAGRFRSGLYFPDEGHLDPRLALASLYQRLCSMGVRFHMGVPVDERPFDRVVDCTGPAAV
GKIPRLRGVRGEMLYLATSEVSLSRPVRLLHPRIPLYVVPREPGRFMVGATMIETEDAGA
ISARSMMEFLNAAYAVHPAFAEAEIIETGTGVRPAYPDNLPDVTEDGRTIFINGAYRHGF
LLSPAMARKAAGIACQTLSKGTGS