Protein Info for Atu2555 in Agrobacterium fabrum C58

Annotation: L-lysine 2,3-aminomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00238: KamA family protein" amino acids 13 to 323 (311 residues), 274.8 bits, see alignment E=9.1e-86 TIGR03822: lysine-2,3-aminomutase-related protein" amino acids 16 to 335 (320 residues), 595.6 bits, see alignment E=2.1e-183 PF13353: Fer4_12" amino acids 110 to 179 (70 residues), 27.6 bits, see alignment E=3.3e-10 PF04055: Radical_SAM" amino acids 111 to 259 (149 residues), 48.9 bits, see alignment E=9e-17

Best Hits

Swiss-Prot: 33% identical to EPMB_ECOLI: L-lysine 2,3-aminomutase (epmB) from Escherichia coli (strain K12)

KEGG orthology group: K01843, lysine 2,3-aminomutase [EC: 5.4.3.2] (inferred from 100% identity to atu:Atu2555)

MetaCyc: 33% identical to lysine 2,3-aminomutase (Escherichia coli K-12 substr. MG1655)
5.4.3.-

Predicted SEED Role

"Lysyl-lysine 2,3-aminomutase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHN5 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Atu2555 L-lysine 2,3-aminomutase (Agrobacterium fabrum C58)
MGARRGIWTMTRFETIKTPEALLEAGLIEAEALEGLRAVTQRYALAITPAVTGLMDSHDP
QDPIARQFVPDLAELVHLPEERDDPIGDDAHSPVHGIVHRYPDRVLLKAVHVCPVYCRFC
FRREMVGPQGNGMMSPEELDAAFAYIKENPAIWEVILTGGDPLVLSPRRLSDLMKRLRDI
PHVKIVRFHTRVPVVDPDRIDAPLIEALKASGKTTYVALHANHARELGDAARNACARLID
AGIAMVSQTVLLKGINDDPAVLADLMRSFVENRIKPYYLHHPDLAPGTSHFRLTIEEGQR
IVSALRGHVSGLCQPTYVLDIPGGHGKAMIGRNAAEKTRDGCYSVSDFNGNDHIYPPATS
GSY