Protein Info for Atu2553 in Agrobacterium fabrum C58

Annotation: elongation factor P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF08207: EFP_N" amino acids 6 to 62 (57 residues), 59.3 bits, see alignment E=4.4e-20 TIGR00038: translation elongation factor P" amino acids 6 to 187 (182 residues), 211.3 bits, see alignment E=4.7e-67 PF01132: EFP" amino acids 72 to 123 (52 residues), 74.7 bits, see alignment E=6.8e-25 PF09285: Elong-fact-P_C" amino acids 131 to 186 (56 residues), 77.1 bits, see alignment E=1e-25

Best Hits

Swiss-Prot: 100% identical to EFP_RHIRD: Elongation factor P (efp) from Rhizobium radiobacter

KEGG orthology group: K02356, elongation factor P (inferred from 100% identity to atu:Atu2553)

MetaCyc: 36% identical to protein chain elongation factor EF-P (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A3B5 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Atu2553 elongation factor P (Agrobacterium fabrum C58)
MVKVIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRIVDGTKVSERWRTTE
QVERAFVEDLNFQFLYEDGEGFHFMNPENYDQVVVDVETMGDQKAYLQEGMTCVLSIHEG
NPLAVELPRHVTLEIVETEPVVKGQTASSSYKPAILSNGIRTMVPPHIDAGIRVVIATED
NSYVERAKN