Protein Info for Atu2551 in Agrobacterium fabrum C58

Annotation: RND multidrug efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1029 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details amino acids 365 to 387 (23 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details amino acids 437 to 459 (23 residues), see Phobius details amino acids 471 to 496 (26 residues), see Phobius details amino acids 535 to 553 (19 residues), see Phobius details amino acids 869 to 887 (19 residues), see Phobius details amino acids 894 to 914 (21 residues), see Phobius details amino acids 920 to 943 (24 residues), see Phobius details amino acids 969 to 990 (22 residues), see Phobius details amino acids 997 to 1023 (27 residues), see Phobius details PF00873: ACR_tran" amino acids 1 to 1024 (1024 residues), 1219.9 bits, see alignment E=0 TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 1 to 1026 (1026 residues), 1517.8 bits, see alignment E=0 PF03176: MMPL" amino acids 242 to 511 (270 residues), 34.5 bits, see alignment E=1.7e-12 PF02355: SecD_SecF_C" amino acids 870 to 1015 (146 residues), 22 bits, see alignment E=1.4e-08

Best Hits

Swiss-Prot: 57% identical to ACRB_ECOLI: Multidrug efflux pump subunit AcrB (acrB) from Escherichia coli (strain K12)

KEGG orthology group: K03296, hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family (inferred from 100% identity to atu:Atu2551)

MetaCyc: 54% identical to multidrug efflux pump RND permease AcrD (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-360

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHN6 at UniProt or InterPro

Protein Sequence (1029 amino acids)

>Atu2551 RND multidrug efflux transporter (Agrobacterium fabrum C58)
MAHFFIRRPVFAWVIAIVIMLGGVLAIWTLSISQYPDIAPTTVRVSATYNGASAETVEKS
VTTIIEDGMTGLDDLTYMTSSSSTGSAEVTLTFGNSILPDIAQVQVQNKLQLVQSQLPDT
VQQQGLQVSRSTSSILMVGALISTDGKRNSADLGDVFSSRVEDQIKRLEGVGSINVFGSE
YAMRIWLDPFKLNKYQLTTADVTGAIQSQNTQVSVGSLGAVPAVKGQQLNVTVTAQSQLT
TVADFEKVILKVEKDGATVRLSDVARIEIGQETYGGDSRSNGRPSAGFAVNLATGANALD
TAARVKAALTNVEGSLPEGVSIEYPYDTTPFVKLSIEKVVHTLIEAIILVFVVLLVFLQN
LRATFIPMIAVPVVLLGTFGVLALTGYSINTLTMFAMVLAIGLLVDDAIVVVENVERIMS
EEGLSPVEATEKSMGEITGAIIGIALVLTAVFIPMAFFGGSTGIIYRQFSITIVSAMLLS
AVVAIVLTPALCATMLKPIDHHKKKRGPGAWFNRGFGKTTDGYVSSIGYLLKRPLRVMII
FAVVIGGCVWFFSKLPSSFLPQEDQGVLLTIIQTPTGSNIERTNEVVKQVENYFREKEAA
NVESVFGVLGFSFSGSGQNNAIVFTKLKDFAERTAPDQHAGAIVQRAMGTFFGFRDAQVF
PLLPPAIQGMGTSSGFSMYLVDSGRNGTDALTASSKELIALATGNPKISSLRSDSQDNET
QMKIVLDQEKMGAMGVDLSSVNLMLSTIFAGRDVNDFTLNGELKPVYVQGDAPYRMQPDD
LKYWYARNTTGEMVPFSSFSEVKWVNAPPSLARFNGTGAISLEGTAGTGVASGEAMDEME
RLTASLPGGYTVAWQGISYQERLSGSQAPMLYALSVLIVFLCLAALYESWSIPFSVILAV
PVGVLGALTAAHFFGQTNDVYFKVGLLTTIGLAAKNAILIVEFAKERQEHGLSLVEAALE
AAKLRLRPIIMTSLAFILGVVPLAIATGAGSAAQNAIGIGVLGGMLSATLLGIFFVPSFF
VIIRRLSRR