Protein Info for Atu2535 in Agrobacterium fabrum C58

Annotation: two component sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 174 to 203 (30 residues), see Phobius details PF00512: HisKA" amino acids 264 to 315 (52 residues), 34.2 bits, see alignment 2.2e-12 PF02518: HATPase_c" amino acids 370 to 465 (96 residues), 64.9 bits, see alignment E=8.8e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2535)

Predicted SEED Role

"two-component sensor kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHN9 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Atu2535 two component sensor kinase (Agrobacterium fabrum C58)
MKKTHDRSLRWGLMKRLFALQAFLLLLFVILLIGWIWIIDPRLEGANEEAARIVAESVTK
DAQGRPQLSLTPELAELKRRYPNLWFVVRDTDDIVLQYGVVPASALSAAFPWSFDRARLE
AAGTVRATVENRDTSAGRLQFIAGTEEGILNEGLSIWINVQLDLEKDAKGAIRWLTVLPA
LGLIILIAVVPMLILTGIATLLVTPRAVGRSLSGLMETVKQAQSIDFDNRSARIDRSKVP
LEIIPLVDAFNVALSKLDDGYNRRNRFLADAAHELRTPIAIVRTRADLLPDDALSRQIRA
DIDRLTRVAHQLLEMQAVGAVELPAEPCDLNKLVEHIATDLAPIAMDAGYEFDFEPSVGA
AIFTVQASIIEMAVVNLVRNAIDHAGGRGAITIRIDAAGAIEVCDEGPGIPVPERGQVFE
PFHRINTNSPGAGLGLNLVQKAAELHRGRVLFLDLNPGFCVRLEIRSVVSKAVAPGNT