Protein Info for Atu2527 in Agrobacterium fabrum C58
Annotation: dioxygenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 100% identity to atu:Atu2527)MetaCyc: 95% identical to hydroxyquinol 1,2-dioxygenase (Rhizobium sp. MTP-10005)
Hydroxyquinol 1,2-dioxygenase. [EC: 1.13.11.37]
Predicted SEED Role
"Catechol 1,2-dioxygenase (EC 1.13.11.1)" in subsystem Catechol branch of beta-ketoadipate pathway (EC 1.13.11.1)
MetaCyc Pathways
- aromatic compounds degradation via β-ketoadipate (8/9 steps found)
- γ-resorcylate degradation I (4/4 steps found)
- superpathway of salicylate degradation (6/7 steps found)
- catechol degradation III (ortho-cleavage pathway) (5/6 steps found)
- γ-resorcylate degradation II (3/4 steps found)
- catechol degradation to β-ketoadipate (3/4 steps found)
- resorcinol degradation (2/3 steps found)
- 4-aminophenol degradation (2/4 steps found)
- 2,4,5-trichlorophenoxyacetate degradation (5/9 steps found)
- 4-nitrophenol degradation II (2/5 steps found)
- mandelate degradation to acetyl-CoA (8/18 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (15/35 steps found)
KEGG Metabolic Maps
- 1,4-Dichlorobenzene degradation
- Benzoate degradation via hydroxylation
- Carbazole degradation
- Fluorobenzoate degradation
- Toluene and xylene degradation
- gamma-Hexachlorocyclohexane degradation
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.13.11.1 or 1.13.11.37
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CHP4 at UniProt or InterPro
Protein Sequence (295 amino acids)
>Atu2527 dioxygenase (Agrobacterium fabrum C58) MDIKMTSDDGYFVEERSAETVIARMRDCDDPRLKEIMAVVTRKLHEAVKEIEPTEEEWMK AIHFLTEVGQICNEWRQEWILFSDILGVSMLVDAINHRKPSGASESTVLGPFHVADAPEM PMGANICLDGKGEDMVVTGRILDTEGAPVAGARIDVWQANDEGFYDVQQKGIQPDFNLRG VFVTGEDGRYWFRAAKPKYYPIPDDGPVGRLLRAMGRHPYRPAHLHYIVSAESFTTLVTH IFDPDDPYIRSDAVFGVKESLLANFDRVEDREKAQELGFAGDWFWSVNHDFVLAR