Protein Info for Atu2521 in Agrobacterium fabrum C58

Annotation: Protein regulated by acid pH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 866 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 57 to 85 (29 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details amino acids 302 to 319 (18 residues), see Phobius details amino acids 340 to 360 (21 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details amino acids 409 to 426 (18 residues), see Phobius details amino acids 428 to 428 (1 residues), see Phobius details amino acids 432 to 451 (20 residues), see Phobius details amino acids 464 to 485 (22 residues), see Phobius details amino acids 507 to 527 (21 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 33 to 311 (279 residues), 33.4 bits, see alignment E=3.5e-12 PF09924: LPG_synthase_C" amino acids 553 to 838 (286 residues), 341 bits, see alignment E=5.4e-106

Best Hits

KEGG orthology group: K14205, phosphatidylglycerol lysyltransferase [EC: 2.3.2.3] (inferred from 100% identity to atu:Atu2521)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHP8 at UniProt or InterPro

Protein Sequence (866 amino acids)

>Atu2521 Protein regulated by acid pH (Agrobacterium fabrum C58)
MADKSEVTETDIIESPVESFFARNRPYLTAIAITLIFVMMTFAIYRLTSEVRYDDVIAAL
LGTSFSAVLLAIVFTALSFLALIFYDANAIEYVGKKVRFPSMAATAFAAYAIGNTAGFGP
LSGGAIRFRAYSRLGLSPGDIARVIAFVTLSFGLGLLSVSALSTFIVAPRIAAIIGFDPL
VLRGGALAVIAILVITAYVGRNGKAIRLGKWRLRLPDSRTSSRQFLVSAFDIAASASVLY
VLLPETHLGWPTFFAIYATAVGLGVLSHVPAGLGVFETVMVAGLGNAISVDQLLGSLVLY
RVIYHVLPLVVAILVMIVSETKQFAAKPVVSDISQLAVRLAPPLLSTFAIILGTMLIFSS
VTPTPDSNLDFLSNFVPLPIIEAAHFLTSILGLGLVVASRGLGQRLDGAWWIALIAASLA
LILSILKAIAVFEAVFLGIFIAALALNMRSFNRHASLVKQALGPSWLAAMAVIIAGAATI
LLFVYRDTDYSHALWWEFEFSEEAPRGLRALLGLVLASSTIAIFSLMRPVTFKPDSIQPE
DVERATDIVMRQDSADANLVRMGDKHVMFSESGNAFIMYGIQGRSWIAFADPVGDEEDFP
DLVWQFVEAARGAGARAAFYQISPFLLSHCADAGLRAFKLGELALVDLTAFELKGGKLAT
LRQSLSRGARDGLTFEVVEQSQVPDIMDELQQVSDGWLAHHNTREKRFSLGAFEPDYILS
QPVAVLRKDGKITAFANLMVTETKKEATIDLMRFSADAPRGSMDFLFVSIMQHLREAGYE
SFNLGMAPMSGMSKRDAAPVWDRIGSTLFEHGERFYNFKGLRAFKAKFHPKWEPRYLAVQ
NGADAALALMDATVLISGGVRGVIGK