Protein Info for Atu2507 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (sugar)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 73 to 98 (26 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 196 to 219 (24 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 91 to 266 (176 residues), 75.8 bits, see alignment E=1.8e-25

Best Hits

Swiss-Prot: 32% identical to Y4OR_SINFN: Probable ABC transporter permease protein y4oR (NGR_a02180) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu2507)

MetaCyc: 35% identical to ABC-type trehalose transporter integral membrane protein (Mycobacterium tuberculosis H37Rv)
7.5.2.-

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHQ9 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Atu2507 ABC transporter, membrane spanning protein (sugar) (Agrobacterium fabrum C58)
MSTKILKRKNLDRIGLFFVALVMISPVILFFIWMISLSLKYEIDNGAYPPILIPERFAWS
NYVKVFEENSFFLYFWNSVLVTGAATILALVIGVPAGYGIARLKAEKSAVVIMIARMTPG
LSFLIPLFLLFQWLNLLGTLWPQIIIHLVVTVPIVVWIMIGYFETTPKELEEAASIDGAS
SWQVFRLVALPIAKPGIVVSFILAVIFSWNNFVFGIVLASRETRTLPVAVYNMLSFEQVS
WGPLAAAALIVTLPVLLLTMFAQKQIVAGLTAGAVKGG