Protein Info for Atu2506 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (sugar)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 28 to 52 (25 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 181 to 198 (18 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 276 to 300 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 101 to 300 (200 residues), 69.8 bits, see alignment E=1.3e-23

Best Hits

Swiss-Prot: 36% identical to MALF_THELN: Trehalose/maltose transport system permease protein MalF (malF) from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu2506)

Predicted SEED Role

"ABC-type sugar transport systems, permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHR0 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Atu2506 ABC transporter, membrane spanning protein (sugar) (Agrobacterium fabrum C58)
MASVSIENTKTGVSRAEGSRPPRLAPNYWPFVIPALVVISAVIVFPWVFTLWMSVHRWTL
GQEQSFIGFDNYIRLASDLRFWESLWHTLIYTVLSVVAPLFLGTLAALVFDAQFPLRGFL
RGVFVMPMMATPVAIALVWTMMFHPQLGVLNYLLSLIGIGPLEWIYNQSTVIPSLVLVET
WQWTPLVMLIVLGGLAAVPREPYESAEIDGANAWQKFRYLTMPMIAPFLMIAVIIRSIDA
VKSFDIIYAMTQGGPGTASETINIYLYNTAFSYYDIGYGSAMAVVFFVIIVALSFVLLMV
RQRSQWNEMEEH