Protein Info for Atu2499 in Agrobacterium fabrum C58
Annotation: Isochorismatase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 94% identical to RUTB_AGRRK: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB) from Agrobacterium radiobacter (strain K84 / ATCC BAA-868)
KEGG orthology group: None (inferred from 99% identity to agr:AGROH133_08498)MetaCyc: 70% identical to ureidoacrylate amidohydrolase / (+)-gamma-lactamase monomer (Escherichia coli K-12 JM109)
3.5.2.-; RXN0-6460 [EC: 3.5.1.110]
Predicted SEED Role
"Predicted amidohydrolase RutB in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization
MetaCyc Pathways
- uracil degradation III (5/5 steps found)
- L-citrulline degradation (3/3 steps found)
- urea degradation I (3/3 steps found)
- L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
- cyanate degradation (2/3 steps found)
- cyanuric acid degradation II (3/5 steps found)
- superpathway of allantoin degradation in yeast (3/6 steps found)
- cyanuric acid degradation I (2/5 steps found)
- allantoin degradation IV (anaerobic) (4/9 steps found)
- superpathway of atrazine degradation (3/8 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.5.1.110
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P58760 at UniProt or InterPro
Protein Sequence (246 amino acids)
>Atu2499 Isochorismatase (Agrobacterium fabrum C58) MSEAVVAGYKGPESRSESVTLPARPEPITLKPSETAVVVVDMQNAYSTEGGYVDLAGFDI SGAKGTIANIKKTLDAARAAGVQVIYFQNGWDKDYVEAGGPGSPNWHKSNALKTMRKRPE LQGQLLAKGTWDYAIVDELQPQPGDILVPKTRYSGFFNTNMDSVLRARGIRNLVFVGIAT NVCVESSLRDAFHLEYFGVMLEDATHHLGPDFIQQATVYNVEKFFGWVATVNDFCGVISQ AAPVTD