Protein Info for Atu2499 in Agrobacterium fabrum C58

Annotation: Isochorismatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR03614: pyrimidine utilization protein B" amino acids 20 to 244 (225 residues), 450.7 bits, see alignment E=4.7e-140 PF00857: Isochorismatase" amino acids 35 to 233 (199 residues), 140.9 bits, see alignment E=2.4e-45

Best Hits

Swiss-Prot: 94% identical to RUTB_AGRRK: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB) from Agrobacterium radiobacter (strain K84 / ATCC BAA-868)

KEGG orthology group: None (inferred from 99% identity to agr:AGROH133_08498)

MetaCyc: 70% identical to ureidoacrylate amidohydrolase / (+)-gamma-lactamase monomer (Escherichia coli K-12 JM109)
3.5.2.-; RXN0-6460 [EC: 3.5.1.110]

Predicted SEED Role

"Predicted amidohydrolase RutB in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.110

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P58760 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Atu2499 Isochorismatase (Agrobacterium fabrum C58)
MSEAVVAGYKGPESRSESVTLPARPEPITLKPSETAVVVVDMQNAYSTEGGYVDLAGFDI
SGAKGTIANIKKTLDAARAAGVQVIYFQNGWDKDYVEAGGPGSPNWHKSNALKTMRKRPE
LQGQLLAKGTWDYAIVDELQPQPGDILVPKTRYSGFFNTNMDSVLRARGIRNLVFVGIAT
NVCVESSLRDAFHLEYFGVMLEDATHHLGPDFIQQATVYNVEKFFGWVATVNDFCGVISQ
AAPVTD