Protein Info for Atu2496 in Agrobacterium fabrum C58
Annotation: nitroreducatase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to Y2496_AGRFC: Putative NADH dehydrogenase/NAD(P)H nitroreductase Atu2496 (Atu2496) from Agrobacterium fabrum (strain C58 / ATCC 33970)
KEGG orthology group: K09019, putative NADH dehydrogenase/NAD(P)H nitroreductase RutE [EC: 1.-.-.-] (inferred from 100% identity to atu:Atu2496)MetaCyc: 69% identical to putative malonic semialdehyde reductase (Escherichia coli K-12 substr. MG1655)
RXN-8974 [EC: 1.1.1.298]
Predicted SEED Role
"Predicted reductase RutE in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization
MetaCyc Pathways
- uracil degradation III (5/5 steps found)
- β-alanine degradation III (1/2 steps found)
- 3-hydroxypropanoate cycle (8/13 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
- glyoxylate assimilation (5/13 steps found)
- superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.- or 1.1.1.298
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P58792 at UniProt or InterPro
Protein Sequence (196 amino acids)
>Atu2496 nitroreducatase (Agrobacterium fabrum C58) MTKSLDDAALATLFTEARTHNGWTDKPIGDETLMALYDLTKMGPTSANCSPARFVFVRSQ EAKEKLKPALSSGNLEKTMAAPVTVIAAIDSEFYEKLPELFPHADARSWFTSSPAVAEET AFRNATLQAGYLILAARALGLDTGAMSGFDKGKVDAAFFAGTTWKSNFLINLGYGDPSKL FGRLPRLGFEDACVLA