Protein Info for Atu2490 in Agrobacterium fabrum C58

Annotation: aspartate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01118: Semialdhyde_dh
  • amino acids 4 to 117 (114 residues), 115.1 bits, E=2.8e-37
• TIGR01296: aspartate-semialdehyde dehydrogenase
  • amino acids 4 to 333 (330 residues), 469.7 bits, E=2.6e-145
• PF02774: Semialdhyde_dhC
  • amino acids 139 to 318 (180 residues), 184.2 bits, E=2.8e-58

Best Hits

Swiss-Prot: 55% identical to DHAS_RICFE: Aspartate-semialdehyde dehydrogenase (asd) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 100% identity to atu:Atu2490)

MetaCyc: 45% identical to aspartate semialdehyde dehydrogenase (Arabidopsis thaliana col)
Aspartate-semialdehyde dehydrogenase. [EC: 1.2.1.11]

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• ectoine biosynthesis (3/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• spermidine biosynthesis II (2/4 steps found)
• norspermidine biosynthesis (3/6 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• superpathway of polyamine biosynthesis III (3/8 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.11

Sequence Analysis Tools

See Q7CWX8 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Atu2490 aspartate-semialdehyde dehydrogenase (Agrobacterium fabrum C58)
MGFKVAIVGATGNVGREMLNILAERGFPADEVVPLASSRSQGTEVSYGDRTLKVSNLENY
DFSDTDICLMSAGGEISKKWSPKIGQQGCVVIDNSSAWRYDQDVPLIVPEVNADAISGFT
RKNIIANPNCSTAQLVVALKPLHDFAKIKRVVVSTYQSVSGAGKEGMDELFQQTRAVFVA
DPVETKKFTKRIAFNVIPHIDVFMEDGYTKEEWKVLAETKKMLDPKIKVTCTAVRVPVFI
GHSESVNIEFENEITADQARDILREAPGCLVIDKHEDGGYITPVESAGEDATYISRIRED
ATVENGLNIWVVSDNLRKGAALNAIQIAELLVNRGLIKPRKAAA