Protein Info for Atu2487 in Agrobacterium fabrum C58

Annotation: pyridoxamine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 TIGR00687: pyridoxal kinase" amino acids 8 to 274 (267 residues), 168.6 bits, see alignment E=9.7e-54 PF08543: Phos_pyr_kin" amino acids 79 to 258 (180 residues), 51.6 bits, see alignment E=9e-18 PF00294: PfkB" amino acids 102 to 244 (143 residues), 41.2 bits, see alignment E=1.4e-14

Best Hits

KEGG orthology group: K00868, pyridoxine kinase [EC: 2.7.1.35] (inferred from 100% identity to atu:Atu2487)

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHR8 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Atu2487 pyridoxamine kinase (Agrobacterium fabrum C58)
MQENTQGAVIVISSHVMRGSVGNRAAVFALETLGYPVWAVPTIVMPWHPGHGPSTRMRFQ
DDDFDKAMTDLGNAQWIGEVKAVLTGYFGSAAQVRSVARLIRNLKEKNPALVYACDPVMG
DLGGLYIPLETAEAIRDHLIPLATVATPNRYELAWMSGAELETNNAIMDAALALGPPKML
VTSAVPMMTGGTGNLYLSGRHALLAEHRAIENAPNGLGDLMSALFLARLLEGVDDEKALQ
LATASVFEILARTKKRGMNELTLETDSSSLSTPMAMVQMRHLLHPSRSKRK