Protein Info for Atu2475 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 228 to 262 (35 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details PF01032: FecCD" amino acids 30 to 318 (289 residues), 160.7 bits, see alignment E=2.4e-51

Best Hits

Swiss-Prot: 46% identical to YCLO_BACSU: Petrobactin import system permease protein YclO (yclO) from Bacillus subtilis (strain 168)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to atu:Atu2475)

Predicted SEED Role

"Iron compound ABC uptake transporter permease protein PiuC" in subsystem Heme, hemin uptake and utilization systems in GramPositives

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHS5 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Atu2475 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MHERHPDRRAKTVLIILAAVSLICMAAFMTLGAKGSWSFVLPFRGIKLLSLLLVAYAIAV
STVLFQTVTNNRILTPSVMGFDSLYVLMQTGLIFVFGSATVVMIDPQLKFIVETALLVIF
SALLYRWLFVGAERSLHLLVLVGIVFGVFFRSLSGFMQRVLDPNEYTVLQDVLFATFNSI
DPTLLTISAIIIGVVTIIGLRLMHTLDVLSLGRATAIGLGVEYKRTVTIILVLVSVLVAV
STALVGPVMFFGLLVAALAHYLTGNGKHAYVLPAAILIAVICLVGGQVALERIFAFDTAL
SIIIEFLGGIVFIGLILKRGAR