Protein Info for Atu2474 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 27 to 55 (29 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 115 to 122 (8 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 246 to 273 (28 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details PF01032: FecCD" amino acids 34 to 337 (304 residues), 212.3 bits, see alignment E=4.5e-67

Best Hits

Swiss-Prot: 51% identical to YCLN_BACSU: Petrobactin import system permease protein YclN (yclN) from Bacillus subtilis (strain 168)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to atu:Atu2474)

Predicted SEED Role

"Petrobactin ABC transporter, permease protein I"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHS6 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Atu2474 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MAPLNTLRGRLNVYQFRNITNVKSLPLISALLLALALAITSLFVGVSNVSLATLFAQDTS
ADALRVLVVSRIPRTLALILAGSSMAIAGLIMQMLVRNRFVEPSTAGTTESAGLGLLVVT
LLAPETPIFGKMLVAAAFALAGTALFLRILRQVPLRDVLLVPLIGIMLGGVIAAITTFFA
YRFDLLQSLGAWMTGDFSGVLRGRYELLWVGFLFAIAAYLAADRFTVAGMGGDFTTNLGL
NYRRVMALGLTIVSLVSAVVVVTVGMIPFLGLIVPNVVSLMIGDNMRRSVPWVATLGAVF
VLSCDIIGRTVRAPYEIPIGTVVGVIGSALFLYLLLRKRHHA