Protein Info for Atu2445 in Agrobacterium fabrum C58

Annotation: RNA polymerase sigma-32 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 TIGR02392: alternative sigma factor RpoH" amino acids 15 to 285 (271 residues), 372.5 bits, see alignment E=1.5e-115 PF00140: Sigma70_r1_2" amino acids 17 to 44 (28 residues), 28.3 bits, see alignment (E = 2.2e-10) TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 48 to 283 (236 residues), 100.3 bits, see alignment E=8.7e-33 PF04542: Sigma70_r2" amino acids 53 to 121 (69 residues), 64.7 bits, see alignment E=7.8e-22 PF04545: Sigma70_r4" amino acids 231 to 281 (51 residues), 56.2 bits, see alignment 3e-19

Best Hits

Swiss-Prot: 100% identical to RPOH_RHIRD: RNA polymerase sigma factor RpoH (rpoH) from Rhizobium radiobacter

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 100% identity to agr:AGROH133_08311)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHU4 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Atu2445 RNA polymerase sigma-32 factor (Agrobacterium fabrum C58)
MARNSLPTITAGEAGLNRYLDEIRKFPMLEPQEEYMLGKRYAEHGDRDAAHKLVTSHLRL
VAKIAMGYRGYGLPIGEVVSEGNVGLMQAVKKFDPERGFRLATYAMWWIKASIQEYILRS
WSLVKMGTTANQKRLFFNLRRLKGRIQAIDDGDLKPEHVKEIATKLQVSEEEVISMNRRL
HGDASLNAPIKASEGESGQWQDWLVDDHESQEAVLIEQDELETRRRMLAKAMGVLNERER
RIFEARRLAEDPVTLEELSSEFDISRERVRQIEVRAFEKVQEAVQKEALEAARALRVVDA