Protein Info for Atu2443 in Agrobacterium fabrum C58

Annotation: ribosomal large subunit pseudouridine synthase, RluD subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 TIGR00005: pseudouridine synthase, RluA family" amino acids 24 to 339 (316 residues), 292.7 bits, see alignment E=1.6e-91 PF01479: S4" amino acids 24 to 71 (48 residues), 41.4 bits, see alignment 1.4e-14 PF00849: PseudoU_synth_2" amino acids 98 to 267 (170 residues), 104.8 bits, see alignment E=7.6e-34

Best Hits

KEGG orthology group: K06180, ribosomal large subunit pseudouridine synthase D [EC: 5.4.99.12] (inferred from 100% identity to atu:Atu2443)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase D (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CX17 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Atu2443 ribosomal large subunit pseudouridine synthase, RluD subfamily (Agrobacterium fabrum C58)
MNDPFKQGGDARKVLIAGEDAEGRIDVWLVGEVGSDLSRSRLKALIEQGAVLLNGQPVTE
PKKKVHPGDRVEIVMPEPEDPVPQGEDIPLDVEYEDEDLIVLVKPAGLVVHPGAGNWTGT
LVNALIYHCGDSLSGIGGVKRPGIVHRLDKETSGVMVVAKNDNAHRHLAAQFADHGRTGP
LERAYKAVVWGRPRTLRGTVDAALGRGTDRTKRAVKNEDSFDAREAITHYEVMERFHEKP
DASCLASMVECRLETGRTHQIRVHMAHIGHPLIGDPEYGAAFRTKANLLDEPARSTVNRF
PRQALHAYLLAFEHPRTGEVMEFETDMPEDMEELVTALRS