Protein Info for Atu2434 in Agrobacterium fabrum C58

Annotation: two component response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 92.5 bits, see alignment E=2e-30

Best Hits

Swiss-Prot: 92% identical to CTRA_BRUC2: Cell cycle response regulator CtrA (ctrA) from Brucella canis (strain ATCC 23365 / NCTC 10854)

KEGG orthology group: K13584, two-component system, cell cycle response regulator CtrA (inferred from 100% identity to agr:AGROH133_08294)

Predicted SEED Role

"Two-component cell cycle transcriptional regulator ctrA, winged helix family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHV0 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Atu2434 two component response regulator (Agrobacterium fabrum C58)
MRVLLIEDDSATAQSIELMLKSESFNVYTTDLGEEGVDLGKLYDYDIILLDLNLPDMSGY
EVLRTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELVARIHAIVRRSK
GHAQSVISTGELIVNLDAKTVEVGGQRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYG
GMDEPELKIIDVFICKLRKKLANAAGGANYIETVWGRGYVLREPDGAAEFLETA