Protein Info for Atu2428 in Agrobacterium fabrum C58

Annotation: exopolysaccharide production protein PssB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF00459: Inositol_P" amino acids 18 to 256 (239 residues), 174.8 bits, see alignment E=1.3e-55 TIGR01331: 3'(2'),5'-bisphosphate nucleotidase" amino acids 19 to 271 (253 residues), 279.3 bits, see alignment E=1.5e-87

Best Hits

KEGG orthology group: K03677, CysQ protein (inferred from 100% identity to atu:Atu2428)

Predicted SEED Role

"3'(2'),5'-bisphosphate nucleotidase (EC 3.1.3.7)" (EC 3.1.3.7)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CX31 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Atu2428 exopolysaccharide production protein PssB (Agrobacterium fabrum C58)
MAKPRYGMPPLPDGCGKEMIDILTKAALDAGQAIMVVHRAGPHVSYKDDCSPVTEADQRA
ETIILEALAAHFPEIPVVAEEAVSNGILPETGAEFFLVDPLDGTKEFISGKDDFTVNIAL
IRNGVPVAGVVYAPCRGQAWTGKDNAAEKLAISGDGAILSRHPIRARRRGASPVALISRS
HCTAKTEAFVAEHGLKDCISVGSSLKFCMLAEGAADIYPRFSRTMMWDTAAGDAVLRAAG
GRTLDCDGQLLAYEVRGDGEDALANPDFIAEGAMAVEQAG