Protein Info for Atu2427 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 140 to 167 (28 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 235 to 259 (25 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 284 (277 residues), 166 bits, see alignment E=5.1e-53

Best Hits

Swiss-Prot: 51% identical to BRAD_PSEAE: High-affinity branched-chain amino acid transport system permease protein BraD (braD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to atu:Atu2427)

MetaCyc: 51% identical to branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHV3 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Atu2427 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MEYFIQQLINGLTLGSIYGLIAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLIATSF
FAGIPVALLLLLMMIVAMLMTGLWNWVIERVAYRPLRGSFRLAPLITAIGMSIALSNFIQ
VTQGPRNKPIPSMVTESYHFGAITVSLKQLIIMVVTSVLLFAFWYIVNKTPLGRAQRATE
QDRKMAALLGVDVDKTISITFIMGAALAAVAGTMYLMYYGVASFSDGFVPGVKAFTAAVL
GGIGSLPGAVLGGLLIGLIESLWSAYFSIAYKDVAAFGILAFVLIFKPTGILGRPEVEKV