Protein Info for Atu2391 in Agrobacterium fabrum C58

Annotation: ABC transporter, substrate binding protein (nitrate/sulfonate/taurine/bicarbonate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF09084: NMT1" amino acids 37 to 255 (219 residues), 133.2 bits, see alignment E=6.6e-43

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to atu:Atu2391)

Predicted SEED Role

"Pyrimidine ABC transporter, substrate-binding component" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHW9 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Atu2391 ABC transporter, substrate binding protein (nitrate/sulfonate/taurine/bicarbonate) (Agrobacterium fabrum C58)
MKMKLASILLAGASVLTAFGAQATDKITLQLKWVTQAQFAGYYVAKDKGFYEAEGLDVDI
KPGGPDIAPAQVLAGGGADVIVDWMPSALATREKGVPLVNIAQPFKSSGMMLTCLKETGI
TKPEDFKGKTLGVWFFGNEYPFLSWMAHLKIPTTGGADGVTVLKQGFNVDPLLQKQAACI
STMTYNEYWQVIDAGIKPEELVTFKYEAEGVATLEDGLYVLEDKLKDAKFREDLVKFVRA
SMKGWKWAEEHPDDAAGIVLENDASGAQTEKHQKRMMGEVAKLTAGSKGALDKADYERTV
KTLLGGGSDPVITKEPAGAYTTEITDAALK