Protein Info for Atu2390 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 106 to 278 (173 residues), 84.1 bits, see alignment E=5.2e-28

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to atu:Atu2390)

Predicted SEED Role

"Pyrimidine ABC transporter, transmembrane component 2" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHX0 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Atu2390 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MTNPSWFIGAILFWLAAWAFNEWLVRRNFTSSLAQRIGRIAVPLLFGLALLVLWEGIVRG
FSVPPILLPAPSAILARLVGSLPILWADFRQTFLKSVLTGYVLGCGLGFLVAILIDRSPF
LQRGLLPIGNFVSALPVVGIAPIMVMWFGFDWQSKVAVVVIMTFFPMLVNTVQGLAASSH
MERDLMRTYAAGWGQTLLKLRLPAAWPFIFNALKINSTLALIGAIVAEFFGTPIVGMGFR
ISAEMGRSNVDMVWAEIAVAALAGSGFYGLVALAERAVTFWHPSVRGGRT