Protein Info for Atu2379 in Agrobacterium fabrum C58

Annotation: phosphomannomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF02878: PGM_PMM_I" amino acids 3 to 135 (133 residues), 81.5 bits, see alignment E=1e-26 PF02879: PGM_PMM_II" amino acids 169 to 253 (85 residues), 34.8 bits, see alignment E=4.1e-12 PF02880: PGM_PMM_III" amino acids 259 to 370 (112 residues), 38.4 bits, see alignment E=2.5e-13 PF00408: PGM_PMM_IV" amino acids 410 to 461 (52 residues), 26 bits, see alignment 1.5e-09

Best Hits

Swiss-Prot: 56% identical to NOEK_SINFN: Phosphomannomutase (noeK) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 100% identity to atu:Atu2379)

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.4.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.8

Use Curated BLAST to search for 5.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CX74 at UniProt or InterPro

Protein Sequence (471 amino acids)

>Atu2379 phosphomannomutase (Agrobacterium fabrum C58)
MSLKFGTSGLRGLSVDLKGKASAVYATAFARHLLTSGQAKVGDPILVGRDFRDSSPDVSA
TCIAALKKAGLNPLDCGTVPTPALALYGLSLKAGALMITGSHIPADRNGIKFYRPDGEID
KQDETAIAALAAEIEAEGISDEAATAEDHSAIAAELFYERNIALLPEKALSGLRIGVYQH
STVARDLFVDVLAHYGADVVPLGRSDSFIPVDTEAVSPETLALLRKWSPEHSLDAIVSAD
GDGDRPLLTDENGVPLRGDLIGLITANFLDAGVVVTPVTSNSGIEASGSFEVIRTKVGSP
FVIAGMAQALAEGKNGVMGFEANGGLLTASAFTLNGRPLSPLPTRDSFLPILAVLLLSAE
QKKPLSEIAAAYRLPVAAADRLENFAQEKSAALMTHLRASRDNLDAFLAPVGAVKDLSDI
DGLRVALTDGSTIHFRPSGNAPEMRCYVEAANQDEAETLLHKGLELIRNFG