Protein Info for Atu2375 in Agrobacterium fabrum C58

Annotation: UDP-hexose transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR00696: glycosyltransferase, WecB/TagA/CpsF family" amino acids 70 to 247 (178 residues), 126.5 bits, see alignment E=4.7e-41 PF03808: Glyco_tran_WecG" amino acids 74 to 243 (170 residues), 185.4 bits, see alignment E=3.7e-59

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2375)

Predicted SEED Role

"UDP-hexose transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CX76 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Atu2375 UDP-hexose transferase (Agrobacterium fabrum C58)
MADAEGPGQDWPVIPLAALPITDATIDETARDFILRATTERVAGARPFYSTSANGQVIAL
CHHDREFDAMLRQADQIHADGMSLVIFSRKFCRQALRERVATTDLVHAVAKRAEETGSRF
YFLGGSEEVNRAAVEEMQRLYPRLVFSGRRNGYFSRAEEDAVLADITTSKTDILWVGFGI
PLEQRFVSRNLDRLSGIAVIKTCGGLFDFLAGRNSRAPQWMQDMGLEWLYRAMLEPKRLG
KRYLLTNPIAIYSLLKYRFGASGQGR