Protein Info for Atu2364 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 26 to 49 (24 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 21 to 127 (107 residues), 53.9 bits, see alignment E=1e-18 PF00528: BPD_transp_1" amino acids 40 to 234 (195 residues), 83.1 bits, see alignment E=1.1e-27

Best Hits

Swiss-Prot: 43% identical to HISQ_ECOLI: Histidine transport system permease protein HisQ (hisQ) from Escherichia coli (strain K12)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to atu:Atu2364)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHY0 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Atu2364 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MASLETTLQLLSPYPPGWGGTLLKGAASTLAISAGAYLIGIVIGLAGALGKLSGNRPLGL
LLNLYTTAIRAVPELILIVGLYYAGTDGLNRLLQLMGLPPLEVNGFVAAVAVLGFVQGAY
MTEVLRGAILAVPNGQIEAARAFGMSPFLRFRRVVLPALLPNALPGLANLWLAVTKDSAL
VAVVGYQELALATRLAGASTKQYFLFFLAAAFLYLAITLVSNLVFSQLERRVRRGQPALA