Protein Info for Atu2350 in Agrobacterium fabrum C58

Annotation: transcriptional regulator, LysR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 90 to 108 (19 residues), see Phobius details PF00126: HTH_1" amino acids 2 to 60 (59 residues), 60.1 bits, see alignment E=1.7e-20 PF03466: LysR_substrate" amino acids 86 to 297 (212 residues), 103.1 bits, see alignment E=1.5e-33

Best Hits

Swiss-Prot: 99% identical to GBPR_RHIRD: HTH-type transcriptional regulator GbpR (gbpR) from Rhizobium radiobacter

KEGG orthology group: None (inferred from 100% identity to atu:Atu2350)

Predicted SEED Role

"FIG00985355: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CX96 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Atu2350 transcriptional regulator, LysR family (Agrobacterium fabrum C58)
MSHLRMLVMIEEHGQVSAAAAAMNMTQPAASRMLSEMEAIVKSPLCQRASRGVVLTKFGE
ALARRARTILLELREASRELNQMKSGSGGSVYIGAVTAPAISLVVPAIRRAMDTYPGIEI
NVQVESSNVLARELLAARHDFIIGRIPDDFDPGLFSIHEIGIERACLVVREGHPLMRGEP
VTLQDLSGYDWVFQPPGALLRRTMEDVFLTHGVAMPRNVINTPSVVLTLALVCNTNAIAP
IAQDMAEFVAGQQADIGRTRILPTDFELVVKPYSIITTKGRVLPPSARLLYDLVLDESRK
LTNT