Protein Info for Atu2329 in Agrobacterium fabrum C58
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 100% identity to atu:Atu2329)MetaCyc: 57% identical to phosphoribosyl 1,2-cyclic phosphate phosphodiesterase (Sinorhizobium meliloti 1021)
RXN0-6710 [EC: 3.1.4.55]
Predicted SEED Role
"Protein RcsF" in subsystem Alkylphosphonate utilization
MetaCyc Pathways
- glyphosate degradation III (7/7 steps found)
- methylphosphonate degradation I (2/5 steps found)
- (aminomethyl)phosphonate degradation (4/8 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.1.4.55
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CI00 at UniProt or InterPro
Protein Sequence (235 amino acids)
>Atu2329 hypothetical protein (Agrobacterium fabrum C58) MRYAIHFTPSPNDPLTQAAAAWLGRDVYSGHAVEPPGTIDLGMQEISYHTALPRRYGFHG TIKAPFRLAEGQSEAALLRDLMYFSGRQDPFTLPQLVVARQENVFSLVPERPCEVLHFFA ARVVQEFDHYRAPLSEAEIERADPDRLSASQLTNLHRWGSPHVMDEFRFQMSLTGGVDPS SSQRIERAVRKVFEPLLTRTLQFSSLALFIEDEPGAPFRVHSLHPMGRVSARKIA