Protein Info for Atu2321 in Agrobacterium fabrum C58

Annotation: D-alanyl-D-alanine carboxypeptidase (penicillin binding protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF00768: Peptidase_S11" amino acids 33 to 254 (222 residues), 200.1 bits, see alignment E=6.1e-63 PF13354: Beta-lactamase2" amino acids 35 to 185 (151 residues), 55.8 bits, see alignment E=6.2e-19 PF05036: SPOR" amino acids 350 to 427 (78 residues), 49.1 bits, see alignment E=8.7e-17

Best Hits

KEGG orthology group: K07258, D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 5/6) [EC: 3.4.16.4] (inferred from 100% identity to atu:Atu2321)

Predicted SEED Role

"D-alanyl-D-alanine carboxypeptidase (EC 3.4.16.4)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.16.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.16.4

Use Curated BLAST to search for 3.4.16.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXC2 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Atu2321 D-alanyl-D-alanine carboxypeptidase (penicillin binding protein) (Agrobacterium fabrum C58)
MSGMVKRGMAGAWVFALTFFCAILSLQASPAQAGYAHFIMDANTGKVLAARNADVLNHPA
SLTKMMTLYMTFEALHAGRLRWDQKITMSKNGASVIPSKLYVRQGQTFTVREAVYGMIVK
SANDMAEGMGDHLGGSEARFAEMMTRKARQLGMSKTVFRNASGLPSKSQVTTARDMARLG
LALQRDFPKEYGLFAMESFSFRGKRIRGHNNLMYRYQGMDGIKTGYTNASGFNLVSAINH
NGRRVVGVVLGGKTARSRDAQMAALLDKAVPQASRSRNTEQLVASANVSRTFDVAAALPP
ASVPLPMFAERRADPVAMQIATANSQMADMMQVSAIPRPAPAAATTGERSRWEVQIAATD
SEAAARSLLANARSNIGSYTGIAPYTEAVQSGSATLYRARFTGFEDQSSAVSACKELKAQ
SYACVVMTSEG