Protein Info for Atu2318 in Agrobacterium fabrum C58

Annotation: L-lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF01070: FMN_dh" amino acids 19 to 381 (363 residues), 469.5 bits, see alignment E=9.8e-145 PF03060: NMO" amino acids 263 to 341 (79 residues), 29.3 bits, see alignment E=9.1e-11 PF01645: Glu_synthase" amino acids 302 to 343 (42 residues), 26.2 bits, see alignment 6.9e-10

Best Hits

Swiss-Prot: 48% identical to LLDD_PSEMY: L-lactate dehydrogenase (lldD) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K00101, L-lactate dehydrogenase (cytochrome) [EC: 1.1.2.3] (inferred from 100% identity to atu:Atu2318)

MetaCyc: 46% identical to L-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
1.1.5.M6 [EC: 1.1.5.M6]; RXN0-7227 [EC: 1.1.5.M6]

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.3

Use Curated BLAST to search for 1.1.2.3 or 1.1.5.M6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CI08 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Atu2318 L-lactate dehydrogenase (Agrobacterium fabrum C58)
MKALSMGKILTIADLKQQAQRRVPKMFFDYADSGAWTESTYRANEDDFAKIKLRQRVLVD
MTDRSLATEMVGEKVSMPVALSPTGLTGMQHADGEMLAAKAAEEFGVPFTLSTMSICSIE
DVASVTSKPFWFQLYVMKDRDFVNNLIDRAKAAGCSALVLTLDLQILGQRHKDLRNGLSA
PPKFTPKHIWQMATRPQWCMDMARTKRRSFGNIVGHAKNVSDLSSLSTWTAEQFDPRLSW
QDVEWIKQRWGGKLILKGILDEEDARAAIDTGADAIIVSNHGGRQLDGAHSSIAMLPKIV
DAVGDRIEVHMDGGIRSGQDVLKAVALGARGTYIGRPFLYGLGAGGKQGVTTALEIIRKE
LDISMALCGKRLITDVDRSILA