Protein Info for Atu2316 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 49 to 67 (19 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details PF01925: TauE" amino acids 1 to 216 (216 residues), 95.3 bits, see alignment E=2.4e-31

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to atu:Atu2316)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXC7 at UniProt or InterPro

Protein Sequence (223 amino acids)

>Atu2316 hypothetical protein (Agrobacterium fabrum C58)
MGLPTVAMGVLGLFMPPVAAAGLLILPSFITNIWQLLAGPDFRAIVKRLWPMMIAIIVGT
LIGIRLMTAGTGIWTTSALGLCLAAYAAYSLLARPVSIPARLESKLSPVMGLVTGLLTGG
TGIFVVPAVPYIQSLGFNRDDLVQALGLSFTVSTVALAAGLASQNAFHVEHLSLSALAVL
PALAGMWLGQKIRYVVSPATFRRWFLICLLVLGVELFFRAFWS