Protein Info for Atu2306 in Agrobacterium fabrum C58

Annotation: methionine aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR00500: methionine aminopeptidase, type I" amino acids 1 to 248 (248 residues), 239.3 bits, see alignment E=2.3e-75 PF00557: Peptidase_M24" amino acids 11 to 240 (230 residues), 137.6 bits, see alignment E=2.5e-44

Best Hits

Swiss-Prot: 46% identical to MAP1_STAES: Methionine aminopeptidase (map) from Staphylococcus epidermidis (strain ATCC 12228)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 100% identity to atu:Atu2306)

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CI17 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Atu2306 methionine aminopeptidase (Agrobacterium fabrum C58)
MVISTDEELDLLKDIGRLCAVAMQTMADALEPGITTAELDAIGRKVLEDNGAQSAPEFCY
KFPGATCISVNEEVAHGIPGPRIIKAGDLVNIDVSAVKNGFFGDTGSSFAVPPVKKDIER
LCRDGKRAMWTGLQQVKTGRPFADIGNAIGAFAKKNRYTLITNLASHGIGRSLHEEPKEL
ATWPDKDERRIMQEGMVFTVEPFLSTGAYWAEDGDDDPWTLYSDPSAPTVQYEHTVVATK
NGPLVLTLVE