Protein Info for Atu2281 in Agrobacterium fabrum C58

Annotation: ABC transporter, substrate binding protein (proline/glycine betaine)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR03414: choline ABC transporter, periplasmic binding protein" amino acids 25 to 315 (291 residues), 453.2 bits, see alignment E=1.8e-140 PF04069: OpuAC" amino acids 33 to 285 (253 residues), 188 bits, see alignment E=1.2e-59

Best Hits

KEGG orthology group: K02002, glycine betaine/proline transport system substrate-binding protein (inferred from 100% identity to atu:Atu2281)

Predicted SEED Role

"L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXG0 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Atu2281 ABC transporter, substrate binding protein (proline/glycine betaine) (Agrobacterium fabrum C58)
MFANRSRCLALAAAISSMTFSAAVAAEPASCGTVRFSDVGWTDITATTATATVLLKSLGY
ETDVKLLSVPVTYTSLKNKDIDVFLGNWMPTMEGDIAPYRDDKSVETLRENLTGAKYTLA
TNAKGAELGIKDFKDIAAHSSELGGKIYGIEPGNDGNRLILDMVAKDSFGLKSFEVVESS
EQGMLSQVARAEKSGEPIVFLGWEPHPMNANFKLTYLTGGDEVFGPNFGGATIYTNVRKG
YVEECPNVGAFLKNLQFSLPMENEIMGKILNDGLEGEAAATAWLKANPAAIEPWFANVKT
KDGSADALPAVKKALGL