Protein Info for Atu2278 in Agrobacterium fabrum C58

Annotation: transcriptional regulator, ArsR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF12840: HTH_20" amino acids 20 to 69 (50 residues), 35.7 bits, see alignment E=6.5e-13 PF01022: HTH_5" amino acids 22 to 67 (46 residues), 41.8 bits, see alignment E=7.6e-15

Best Hits

Swiss-Prot: 50% identical to HLYU_VIBCH: Transcriptional activator HlyU (hlyU) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 98% identity to agr:AGROH133_07906)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXG3 at UniProt or InterPro

Protein Sequence (106 amino acids)

>Atu2278 transcriptional regulator, ArsR family (Agrobacterium fabrum C58)
MDNQSLSEHSIAAADLLSAMANPKRLMILCTLVDTEVPVGVLASQVGLSQSALSQHLSKL
RAQRLVKTRRDAQTIYYSSNSESVKKILASLEDIYCQAQKSSKTAA