Protein Info for Atu2271 in Agrobacterium fabrum C58

Annotation: urease accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 55 (19 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details PF04955: HupE_UreJ" amino acids 12 to 192 (181 residues), 192.6 bits, see alignment E=2.1e-61

Best Hits

Swiss-Prot: 48% identical to HUPE_RHILV: Protein HupE (hupE) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K03192, urease accessory protein (inferred from 100% identity to atu:Atu2271)

Predicted SEED Role

"Nickel-binding accessory protein UreJ-HupE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXH0 at UniProt or InterPro

Protein Sequence (196 amino acids)

>Atu2271 urease accessory protein (Agrobacterium fabrum C58)
MLKRLSLAAAALGLTTLPAFAHLNPEEHGSFMAGVSHPFFGADHILAMVAVGIWASQIAS
ARNDRKALWIVPAAFVGTMAVGFLMAVYGVELPFVEPAILASVIGLGLLVAMAARLPTAA
AAAVVGAFALFHGHAHGGELGSAGALQFGIGFMIATAILHLAGIALGLGIARFGSAASRT
VGALTAIAGLSLAFGG