Protein Info for Atu2270 in Agrobacterium fabrum C58

Annotation: ATP-dependent Clp protease, proteolytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 85 to 104 (20 residues), see Phobius details PF00574: CLP_protease" amino acids 20 to 189 (170 residues), 224.8 bits, see alignment E=4e-71

Best Hits

Swiss-Prot: 100% identical to CLPP3_AGRFC: ATP-dependent Clp protease proteolytic subunit 3 (clpP3) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01358, ATP-dependent Clp protease, protease subunit [EC: 3.4.21.92] (inferred from 100% identity to atu:Atu2270)

MetaCyc: 44% identical to ClpP3 (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent or cAMP signaling in bacteria (EC 3.4.21.92)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UD57 at UniProt or InterPro

Protein Sequence (193 amino acids)

>Atu2270 ATP-dependent Clp protease, proteolytic subunit (Agrobacterium fabrum C58)
MNEDEDDKSKELPIGKETEANLFKSRSIFIYGGITQELAQKVCTQLVALAAASDDDIRVY
VNSPGGHVESGDSIHDMIKFIKPKVYIIGTGWVASAGALIYVSVPKERRLCLPNTRFLLH
QPSGGTRGMASDIEIQAREIIKMNQRLIKIFSKATGQTEEKIAKDIDRDYWLSADDAKDY
GLVGKIVESQSEL