Protein Info for Atu2261 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 66% identical to YQJG_ECOLI: Glutathionyl-hydroquinone reductase YqjG (yqjG) from Escherichia coli (strain K12)

KEGG orthology group: K07393, putative glutathione S-transferase (inferred from 100% identity to atu:Atu2261)

MetaCyc: 66% identical to glutathionyl-hydroquinone reductase YqjG (Escherichia coli K-12 substr. MG1655)
RXN0-7010 [EC: 1.8.5.7]

Predicted SEED Role

"Glutathione S-transferase, omega (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

4-hydroxy-2-nonenal detoxification (1/4 steps found)
glutathione-mediated detoxification I (3/8 steps found)
pentachlorophenol degradation (4/10 steps found)
gliotoxin biosynthesis (2/9 steps found)
glutathione-mediated detoxification II (1/9 steps found)
indole glucosinolate activation (intact plant cell) (3/12 steps found)
camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 1.8.5.7 or 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXH7 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Atu2261 hypothetical protein (Agrobacterium fabrum C58)
MGMLVEGVWKDVWYDTKETKGHFKRSASQFRNWVTVDGAVGPSGEGGFEAEKDRYHLYVS
FACPWAHRTLIFRKLKKLEDLISVSVVDPLMLENGWEFKPEGERTPGATQDHLFGSSTLW
QVYTKADPTYSGRVTVPVLWDKKRGTIVSNESAEIIRMFNVAFNDLTGSDADYYPKALRA
EIDALNDVIYDTVNNGVYKAGFATTQDAYQQNAVKVFETLDMLEDRLKDRRFLFGSEQTE
ADWRLFTTLVRFDPVYVGHFKCNIRRIHDYPHLTGYLRDLYQTPGVPDTVDMRHIKEHYY
RSHRTINPTGIVPIGPELDLTMAHGREALS