Protein Info for Atu2220 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 66 to 76 (11 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 141 to 157 (17 residues), see Phobius details amino acids 165 to 182 (18 residues), see Phobius details amino acids 187 to 204 (18 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details PF13231: PMT_2" amino acids 64 to 228 (165 residues), 63.5 bits, see alignment E=2.8e-21 PF02366: PMT" amino acids 85 to 211 (127 residues), 45.5 bits, see alignment E=7.2e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2220)

Predicted SEED Role

"FIG00365166: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXL2 at UniProt or InterPro

Protein Sequence (496 amino acids)

>Atu2220 hypothetical protein (Agrobacterium fabrum C58)
MHDGVALPHAQASEQHRWLTFAIAAIIVVTVLRVVGLAFNRTDLFVDEAQYWLWGREMAL
GAYSKPPLIGWLIRAATILGGGEGTFQVRLAAPVVHGVAAAAILVLGRMVYDIRLASLAA
LVYLTLPAVTLGSLLISTDTPMMLFIVLSMISVRKLAQARAESRGALGWSIALGLCFGLG
LMSKYAMIYFLPCFIAAGWLCEAWRIRLRDAAIAVLICGAVIAPNLWWNAAHDFMTARHT
ADNANWHGVQLKVGSALEFFFSQAGVVGPFVFVGMIVATIRAKTAEDRALVALSVPIVLL
ITAQGLMSRSLANWAVGAYAAGVLLAVPVLASRRWLTVSTLVLGGVVAVALPLMTIAGTE
LRLPKGELAMARYLGRSELVSTGLSRAREAGADAIVANDRSILAELFYQLRDEKQVLTRA
LPETGVPSSHYALLYPLKSGEAKNPLFLAGVDGLPACLAGEAPVAHWTAGPGFLEGREIG
LWRLPPQCIPGGAHGQ