Protein Info for Atu2199 in Agrobacterium fabrum C58

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details PF00892: EamA" amino acids 7 to 139 (133 residues), 68.5 bits, see alignment E=3.9e-23 amino acids 148 to 282 (135 residues), 66.6 bits, see alignment E=1.5e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2199)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CI67 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Atu2199 permease (Agrobacterium fabrum C58)
MTRVQANMLLLLAAAIWGGGFVAQSSAMSSIGPFWFVGLRFAIAAIAVLPFALMETRSLK
SPPRRREIGSFILVGLALFGGATTQQVGLLTTTVTNSSFLTGLYVIFVPVIAVVLYRRHP
HWVVWPCALMMLGGIFLLSGGAFETLTTGDILSIICAFFWAIQITLAGRFVSESGRPLAL
SFTQFAVCSLLSCMIGVVFEPISMAAIEASMMEILYVGLVSSGLAFVLQVIGQRYTTAPQ
AAIFLSSEALFGALMASIFLKETISSAGYVGCLIIFVAILIVELVPELTRKRQKTVAEAS