Protein Info for Atu2170 in Agrobacterium fabrum C58

Annotation: carbamoylphosphate synthase small chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01368: carbamoyl-phosphate synthase, small subunit
  • amino acids 14 to 390 (377 residues), 415.7 bits, E=7.4e-129
• PF00988: CPSase_sm_chain
  • amino acids 16 to 145 (130 residues), 153.3 bits, E=4.4e-49
• PF00117: GATase
  • amino acids 210 to 387 (178 residues), 184.3 bits, E=3.1e-58
• PF07722: Peptidase_C26
  • amino acids 264 to 310 (47 residues), 24.1 bits, 4.3e-09

Best Hits

Swiss-Prot: 100% identical to CARA_AGRFC: Carbamoyl-phosphate synthase small chain (carA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01956, carbamoyl-phosphate synthase small subunit [EC: 6.3.5.5] (inferred from 100% identity to atu:Atu2170)

Predicted SEED Role

"Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)" in subsystem De Novo Pyrimidine Synthesis or Macromolecular synthesis operon (EC 6.3.5.5)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• UMP biosynthesis II (6/6 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• UMP biosynthesis I (5/6 steps found)
• UMP biosynthesis III (5/6 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• allantoin degradation IV (anaerobic) (4/9 steps found)
• guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

• Glutamate metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Sequence Analysis Tools

See Q8UDF7 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Atu2170 carbamoylphosphate synthase small chain (Agrobacterium fabrum C58)
MTETAPWTTRKPTAMLVLADGTVIEGTGIGATGKVQAEVCFNTALTGYEEILTDPSYLGQ
IVTFTFPHIGNVGTNEEDIEDLTPAARRGAVGVIFKADITDPSNFRAVKHLDAWLKARGV
IGLCGIDTRALTAWIRENGAPNAVIAHDPNGVFDIEALKAEAKAWSGLVGLDLAIEATSG
QSSTWTETPWVWNKGYGTLGEADAKYHVVCVDFGVKRNILRLFAGLDCKVTVVPAQTSAE
DILALKPDGVFLSNGPGDPAATGEYAVPVIQNLIKSELPIFGICLGHQMLGLAVGAKTEK
MHQGHHGANHPVKDFTTGKVEIVSMNHGFAVDTKSLPEGVEETHTSLFDGTNCGLRIVGK
PVFSVQHHPEASPGPQDSHYLFRRFVNLLRENKGEAALAER