Protein Info for Atu2149 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 54 to 78 (25 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 183 to 208 (26 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 234 (149 residues), 37.4 bits, see alignment E=1.2e-13

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 99% identity to agr:AGROH133_07546)

Predicted SEED Role

"Thiamin ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXR8 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Atu2149 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MKRFFAWGALTFGLLYFALPLIGMTNFSLKMRRGEYSFDAYGKVLTDPRFQETFSYSVVM
ALFTIVFGVLLVVPTAYWVRLKLPGLRPYIEFITLLPLVIPAIVIVFGYIRLYNTSSWLP
LTGTTFGTNLLLMFGYATLALPYMYRAVDTGLRTIDVSTLTEAAQSLGAGWTTILSRIIL
PNVLVAVLSGAFLTFAIVIGEFTMAALLNRPAFGPYMQLLGANRAYEPAALAVISFGITW
GCLGLIQLVSRYQKGAPPKA