Protein Info for Atu2136 in Agrobacterium fabrum C58

Annotation: chromosome partitioning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF13614: AAA_31" amino acids 1 to 49 (49 residues), 44.3 bits, see alignment 4.9e-15 amino acids 67 to 136 (70 residues), 27.5 bits, see alignment E=7.2e-10 PF07015: VirC1" amino acids 1 to 198 (198 residues), 54.6 bits, see alignment E=2.5e-18 PF09140: MipZ" amino acids 3 to 40 (38 residues), 27.4 bits, see alignment 5.3e-10 PF01656: CbiA" amino acids 4 to 178 (175 residues), 54.3 bits, see alignment E=3.3e-18

Best Hits

Swiss-Prot: 35% identical to PARA_RHIRD: Protein ParA (parA) from Rhizobium radiobacter

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 100% identity to atu:Atu2136)

Predicted SEED Role

"Plasmid partitioning protein ParA" in subsystem pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CI95 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Atu2136 chromosome partitioning protein (Agrobacterium fabrum C58)
MSVITFANTKGGAGKTTAVLLLATELARSGHRVTVLDADPQLWISRWHELSGEIENLSVI
SHVTIASLEGHIRENKTNTDCFIIDLPGAKTPLLTMALGISDHVLIPVQGSAMDARGAAE
VLDHIEFLNRRMGKEIAHSIVLTRVNAMVATRSLLLVKMLLAEKNVSVLNTAIVERAAYR
DIFDYGGTLLCLDCKKVSNIDKAVENATAFAEEVIKLLPKRLPRRVAHLARLVTRKAA