Protein Info for Atu2099 in Agrobacterium fabrum C58

Annotation: UDP-N-acetylmuramoylalanyl-D-glutamate-2,6- diaminopimelate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 TIGR01085: UDP-N-acetylmuramyl-tripeptide synthetase" amino acids 25 to 481 (457 residues), 454.8 bits, see alignment E=2e-140 PF01225: Mur_ligase" amino acids 26 to 98 (73 residues), 34.9 bits, see alignment E=2.5e-12 PF08245: Mur_ligase_M" amino acids 108 to 311 (204 residues), 175.4 bits, see alignment E=2.2e-55 PF02875: Mur_ligase_C" amino acids 333 to 457 (125 residues), 115.7 bits, see alignment E=3.9e-37

Best Hits

Swiss-Prot: 100% identical to MURE_AGRFC: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (murE) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01928, UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [EC: 6.3.2.13] (inferred from 100% identity to atu:Atu2099)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC 6.3.2.13)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UDM3 at UniProt or InterPro

Protein Sequence (489 amino acids)

>Atu2099 UDP-N-acetylmuramoylalanyl-D-glutamate-2,6- diaminopimelate ligase (Agrobacterium fabrum C58)
MNLRDISGNAFPELKELLLSEIGAIEIGGITADSRKAAPGSLFVAVAGTKADGAAYVKDA
VAKGAVAVVSGHAVEADVPVLVVTDPRLYLSLAASRFYGKQPDTMVAVTGTAGKTSVASF
VRQIWAFAGHAAAQIGTTGVIAPGREDYGALTTPDPVTLHALLAELASEGVTHAAMEASS
HGLDQRRLDGVHLSAAGFTNLGRDHMDYHPTIEDYMAAKMRLFDTLMEKGAPAVIFADDP
WSDKAIGAAREAGLEVRTVGRNGQYLTLKRVEHFRHKQMIEVHHDGVIFEVDIPLAGDFQ
VANALVAAGLAMSTGVPAATALKALEKLVGAAGRLELVGQTKNGALAYVDYAHKPDALEN
VLTSVRPFTSGRIITVFGCGGDRDKGKRPIMGEVATRLSDIVIVTDDNPRSEDAATIRSE
VMAAAAGALEIGDRAEAIRHAVSMLSHGDTLIVAGKGHEEGQIVGSVTLPFSDHEQVRSA
LAELEGSKI