Protein Info for Atu2098 in Agrobacterium fabrum C58

Annotation: UDP-MurNAc-pentapeptide synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01225: Mur_ligase
  • amino acids 26 to 100 (75 residues), 52.7 bits, E=6.8e-18
• TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  • amino acids 31 to 463 (433 residues), 380.5 bits, E=5.4e-118
• PF08245: Mur_ligase_M
  • amino acids 112 to 301 (190 residues), 177 bits, E=7.1e-56
• PF02875: Mur_ligase_C
  • amino acids 338 to 451 (114 residues), 63.3 bits, E=6.1e-21

Best Hits

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 100% identity to atu:Atu2098)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• Lysine biosynthesis
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Sequence Analysis Tools

See A9CIA7 at UniProt or InterPro

Protein Sequence (477 amino acids)

>Atu2098 UDP-MurNAc-pentapeptide synthetase (Agrobacterium fabrum C58)
MSWLWTVADMIAITAGRPVGNLPTGITGISIDSRTVKQGEAFFAIKGDRVDGHDYTSFAV
ANGASLLVVAEAKLPALGRLTVPMIVVEDVLAALGKLALAARERTSARIIAVTGSVGKTT
TKEMLRQALAPSGRVHAAVASFNNHWGVPLTLARMPADTEFGVFEIGMNHSGEIRPLVKM
VRPHVAIITTIAPAHLGNFKNIEEIAAAKAEIFEGVEEGGSVILNRDNAQFEQLEEAAQE
AGIEHILTFGQHAKADFRLADFESTTTGSTIWAILNGETSELHINIPGRHIADNAMAVLG
AVAVTGANLDRALEALGTLEAVKGRGQRHHLTINGGSFLLIDESYNANPASMRAAIAVLA
ETETQGHGRRVAVLGDMLEMGEFSAQLHEELAGPLLAAGIEHVWLAGEAMAALRDALPDS
VTVIWFPTTAELTDFALQWVQPGDALMVKSSLGLGFGKIVAALLDKYPAFPETERQV