Protein Info for Atu2096 in Agrobacterium fabrum C58

Annotation: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase
  • amino acids 11 to 454 (444 residues), 352.7 bits, E=1.7e-109
• PF08245: Mur_ligase_M
  • amino acids 119 to 297 (179 residues), 104.4 bits, E=8.4e-34
• PF02875: Mur_ligase_C
  • amino acids 318 to 379 (62 residues), 28.9 bits, E=1.2e-10

Best Hits

Swiss-Prot: 100% identical to MURD_AGRFC: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 100% identity to atu:Atu2096)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

See Q8UDM6 at UniProt or InterPro

Protein Sequence (469 amino acids)

>Atu2096 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase (Agrobacterium fabrum C58)
MIPVTSFRGKKVALFGLGGSGLVTARALVAGGAAVVAFDDNPDSVAKAQAEGIATADLHT
IDWSSFSSFVLAPGVPLTHPKPHWSVDLAKAAGVEVIGDIELFIRERRVHAPDCPFIAIT
GTNGKSTTTALIAHILQSSGRDTQLGGNIGTAVLSLDPPKAQRFYVVECSSYQIDLAPTI
NPTAGILLNLTPDHLDRHGTMQHYADVKERLVAGSGTAIVGVDDSHSTLIADRIERAGVK
VERISKRNVVSEGLYAEGSQILRAHGGTSSLLVDLDGIQTLRGSHNAQNAAAAIAACLAV
GVSEEEIRAGLKSFPGLKHRMQPVGRRGNVTFVNDSKATNADAAAPALSSFDRIYWIAGG
LPKAGGITSLSPLFPRIAKAYLIGEAAAEFAATLGEAVPYEISGTLDKAVQHAAADAEKD
ATAGNVVMLSPACASFDQYKNFEIRGDSFVAQVAALEGMTMLVHSGKGG