Protein Info for Atu2095 in Agrobacterium fabrum C58

Annotation: cell division protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 177 to 210 (34 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details TIGR02614: cell division protein FtsW" amino acids 18 to 363 (346 residues), 354.5 bits, see alignment E=3.3e-110 PF01098: FTSW_RODA_SPOVE" amino acids 23 to 364 (342 residues), 268.2 bits, see alignment E=5.3e-84

Best Hits

Swiss-Prot: 48% identical to FTSW_CAUVN: Probable peptidoglycan glycosyltransferase FtsW (ftsW) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03588, cell division protein FtsW (inferred from 100% identity to atu:Atu2095)

Predicted SEED Role

"Cell division protein FtsW" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIA8 at UniProt or InterPro

Protein Sequence (384 amino acids)

>Atu2095 cell division protein (Agrobacterium fabrum C58)
MVSRVDRGPVAEWFWTIDRFFLAAFVALMGIGLMLSFAASPAVAERIGLNSFFFVERQAM
FMVPSLAIMVGLSFLSPRQVRRVAVIMLIAALLMMIFALFFGIEVKGARRWISIGTFSIQ
PSEFMKPAFVIVCAWLFAERARHPEIPGNLFAIITFGIVAALLIAQPDFGQTILTSVVWG
GMFFMAGVPWFWIIMLGGLGVGGIVTAYLMLPHVAGRIDRFWTGEGDTFQVDTAREAIIR
GDWFGRGPGEGIVKRIIPDSHTDFIFSVAAEEFGIIFCMFLVAIFAFIVLRGLSHAFKEK
DDFCRFAVAGLVLQIGMQSMINIGVNLELMPAKGMTLPLISYGGSSMMAICVTAGFLLAL
TRHRPEKRAQERSFFRVGSGVPAE