Protein Info for Atu2092 in Agrobacterium fabrum C58

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase" amino acids 34 to 307 (274 residues), 164.1 bits, see alignment E=2.1e-52 PF01565: FAD_binding_4" amino acids 43 to 173 (131 residues), 57.1 bits, see alignment E=1.7e-19 PF02873: MurB_C" amino acids 207 to 305 (99 residues), 108.1 bits, see alignment E=2.2e-35

Best Hits

Swiss-Prot: 100% identical to MURB_AGRFC: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 100% identity to atu:Atu2092)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UDN0 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Atu2092 UDP-N-acetylenolpyruvoylglucosamine reductase (Agrobacterium fabrum C58)
MRQVDGVKLLGRLGDGVNELRGRLTPDAPMDRVTWFRAGGLAEVMFQPHDTDDLIAFLKI
LPEDVPLTVVGVGSNLLVRDGGIPGVVVRLSAKGFGSVELADENRIKAGAICPDKHIAAM
AMDNGIGGFHFYYGIPGSIGGALRMNAGANGGETRERVVEVYAVDRQGNQHVLSNADMGY
SYRHSGADAGLIFTGALFEGYPEDKAKIRADMDAVRHHRETVQPIREQTGGSTFKNPEGH
SAWELIDEAGGRGLVIGGAQMSSLHCNFMINTGHATGYDLEYLGETIRRRVFEKSGIRLE
WEIKRLGLFMPGREVEPFLGA