Protein Info for Atu2088 in Agrobacterium fabrum C58

Annotation: cell division protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF08478: POTRA_1" amino acids 97 to 165 (69 residues), 66.4 bits, see alignment E=2.4e-22 PF03799: FtsQ_DivIB_C" amino acids 170 to 282 (113 residues), 70.4 bits, see alignment E=2.4e-23

Best Hits

Swiss-Prot: 100% identical to FTSQ_AGRFC: Cell division protein FtsQ (ftsQ) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03589, cell division protein FtsQ (inferred from 100% identity to atu:Atu2088)

Predicted SEED Role

"Cell division protein FtsQ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIB0 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Atu2088 cell division protein (Agrobacterium fabrum C58)
MDGGGRFVFAVTGKKSTAKKREQYAATANADDRRVLPRPLRRFVRFGVSLATGRIHIPAH
TGTISAVAFYAMIGLYGMSLGGHTNIVTQTTTSAAGFAVEDVKVSGNLQTSEIEVFQLLG
LDGSTSLIALDIDAARRKLVQLPWVEDVDIRKVYPKTVEVRLKERQAFGIWQHGTELSLI
EKSGSVIAPLRDNKFAALPLFVGRDAETGAAGFVAQLADWPEIRNRVRAYVRIAGRRWDL
HLDNGIVVKLPEENLPQALQLLARLDLEEKVLSRDVAAVDLRLTDRTTIQLTEGAAERRQ
TAVDARTKALKKAEKNT