Protein Info for Atu2084 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 18 to 256 (239 residues), 271.1 bits, see alignment E=4e-85 PF13525: YfiO" amino acids 48 to 243 (196 residues), 169.9 bits, see alignment E=9.7e-54 PF13512: TPR_18" amino acids 49 to 174 (126 residues), 51 bits, see alignment E=2.8e-17 PF13174: TPR_6" amino acids 51 to 81 (31 residues), 17.9 bits, see alignment 5.7e-07 amino acids 222 to 253 (32 residues), 17.5 bits, see alignment 7.7e-07

Best Hits

Swiss-Prot: 58% identical to BAMD_RHILO: Outer membrane protein assembly factor BamD (bamD) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K05807, putative lipoprotein (inferred from 100% identity to atu:Atu2084)

Predicted SEED Role

"competence lipoprotein ComL, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXX0 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Atu2084 hypothetical protein (Agrobacterium fabrum C58)
MKHVGSGAMKGTMRGIAVSLMLVGASVVVTACQSDPDIDITKLGVETDPPDVLYKQGLAN
MNAGNMTEASRKFEAIDKQYPFTEWGQKALVMQTFIATRTNKNDVAITSGSRFLRQYPRS
KDAAYVQYMIGLAYSKQISDVTQDQRAAQRTIEAMNKVVNDYPSSEYVADAQAKIRFARD
QLAGREMQVGRYYLERKEYLAAVSRFRIVVEQYQNTNQIEEALARLTEAYYAMGLVDEAQ
TAAAVLGNNYPDSQWYADSYKLLKGQGLEPRENKGSWISRAGKKLIGA