Protein Info for Atu2080 in Agrobacterium fabrum C58

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF13302: Acetyltransf_3" amino acids 19 to 152 (134 residues), 46 bits, see alignment E=2.7e-15 PF13420: Acetyltransf_4" amino acids 21 to 171 (151 residues), 42 bits, see alignment E=3.2e-14 PF13673: Acetyltransf_10" amino acids 56 to 156 (101 residues), 31.2 bits, see alignment E=5.9e-11 PF00583: Acetyltransf_1" amino acids 56 to 151 (96 residues), 62 bits, see alignment E=2e-20 PF13508: Acetyltransf_7" amino acids 71 to 152 (82 residues), 43.6 bits, see alignment E=9.4e-15 PF08445: FR47" amino acids 99 to 153 (55 residues), 22.4 bits, see alignment E=3e-08

Best Hits

KEGG orthology group: K03825, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to atu:Atu2080)

Predicted SEED Role

"Probable acetyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIB5 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Atu2080 acetyltransferase (Agrobacterium fabrum C58)
MHTVKIADNEDRQFQLSDVILRAARLDDAEALTELFNLPGVRYGTLRQPFQSVEKTRKAM
ENRGPNDIAIIGEWHGKIVANGGLYRRAGRQAHIADLVISVHDDFAGKGVGSHLLGALID
TADNWHDIRRIELNVFTDNLPAIRLYEKFGFEREGTLRNDAYRDGKYVDAHVMARLR