Protein Info for Atu2035 in Agrobacterium fabrum C58

Annotation: acetolactate synthase, small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00119: acetolactate synthase, small subunit
  • amino acids 23 to 186 (164 residues), 166.3 bits, E=2.6e-53
• PF01842: ACT
  • amino acids 24 to 89 (66 residues), 50.3 bits, E=2.3e-17
• PF13710: ACT_5
  • amino acids 32 to 95 (64 residues), 44 bits, E=2.4e-15
• PF10369: ALS_ss_C
  • amino acids 113 to 186 (74 residues), 87.1 bits, E=1.1e-28

Best Hits

Swiss-Prot: 44% identical to ILVH_ARCFU: Probable acetolactate synthase small subunit (ilvH) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 100% identity to atu:Atu2035)

MetaCyc: 43% identical to acetolactate synthase / acetohydroxybutanoate synthase, regulatory subunit (Escherichia coli K-12 substr. MG1655)
Acetolactate synthase. [EC: 2.2.1.6]; 2.2.1.6 [EC: 2.2.1.6]

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• pyruvate fermentation to (R)-acetoin I (3/3 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• superpathway of (R,R)-butanediol biosynthesis (4/5 steps found)
• pyruvate fermentation to (S)-acetoin (2/3 steps found)
• pyruvate fermentation to (R)-acetoin II (1/2 steps found)
• L-isoleucine biosynthesis II (5/8 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• L-isoleucine biosynthesis IV (3/6 steps found)
• superpathway of L-threonine metabolism (11/18 steps found)
• superpathway of 2,3-butanediol biosynthesis (2/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

See A9CID3 at UniProt or InterPro

Protein Sequence (190 amino acids)

>Atu2035 acetolactate synthase, small subunit (Agrobacterium fabrum C58)
MNAHLQPTGSAYFIQKETAAVENHTLSVLVSNEPGVLARVIGLFSGRGYNIESLTVSETE
HEAHLSRITIVTRGTPIVLEQIKAQLERIVPVHRVLDLTVRARELGQERPIEREVALIKV
AGTGEVRAEALRLADAFQAKVVDATVEHFIFEITGKSSKIDQFVAIIKPLGLIEICRTGI
AAMNRGSQGM