Protein Info for Atu2035 in Agrobacterium fabrum C58

Annotation: acetolactate synthase, small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 TIGR00119: acetolactate synthase, small subunit" amino acids 23 to 186 (164 residues), 166.3 bits, see alignment E=2.6e-53 PF01842: ACT" amino acids 24 to 89 (66 residues), 49.1 bits, see alignment E=7.6e-17 PF22629: ACT_AHAS_ss" amino acids 26 to 93 (68 residues), 67.4 bits, see alignment E=2.1e-22 PF13710: ACT_5" amino acids 32 to 95 (64 residues), 44.4 bits, see alignment E=2.4e-15 PF10369: ALS_ss_C" amino acids 113 to 186 (74 residues), 87.8 bits, see alignment E=7.9e-29

Best Hits

Swiss-Prot: 44% identical to ILVH_ARCFU: Probable acetolactate synthase small subunit (ilvH) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 100% identity to atu:Atu2035)

MetaCyc: 43% identical to acetolactate synthase / acetohydroxybutanoate synthase, regulatory subunit (Escherichia coli K-12 substr. MG1655)
Acetolactate synthase. [EC: 2.2.1.6]; 2.2.1.6 [EC: 2.2.1.6]

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CID3 at UniProt or InterPro

Protein Sequence (190 amino acids)

>Atu2035 acetolactate synthase, small subunit (Agrobacterium fabrum C58)
MNAHLQPTGSAYFIQKETAAVENHTLSVLVSNEPGVLARVIGLFSGRGYNIESLTVSETE
HEAHLSRITIVTRGTPIVLEQIKAQLERIVPVHRVLDLTVRARELGQERPIEREVALIKV
AGTGEVRAEALRLADAFQAKVVDATVEHFIFEITGKSSKIDQFVAIIKPLGLIEICRTGI
AAMNRGSQGM